Anti MLH1 pAb (ATL-HPA060714)

Atlas Antibodies

Catalog No: ATL-HPA060714-25

• 

Product Description

Protein Description: mutL homolog 1
Gene Name: MLH1
Alternative Gene Name: COCA2, FCC2, HNPCC, HNPCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032498: 94%, ENSRNOG00000033809: 93%
Entrez Gene ID: 4292
Uniprot ID: P40692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV
• Gene Sequence: IATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV
• Gene ID - Mouse: ENSMUSG00000032498
• Gene ID - Rat: ENSRNOG00000033809
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.