Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA067533-25

• 
• 

Product Description

Protein Description: megalencephalic leukoencephalopathy with subcortical cysts 1
Gene Name: MLC1
Alternative Gene Name: KIAA0027, LVM, MLC, VL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035805: 85%, ENSRNOG00000032871: 85%
Entrez Gene ID: 23209
Uniprot ID: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
• Gene Sequence: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
• Gene ID - Mouse: ENSMUSG00000035805
• Gene ID - Rat: ENSRNOG00000032871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.