Protein Description: megalencephalic leukoencephalopathy with subcortical cysts 1
Gene Name: MLC1
Alternative Gene Name: KIAA0027, LVM, MLC, VL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035805: 85%, ENSRNOG00000032871: 85%
Entrez Gene ID: 23209
Uniprot ID: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MLC1
Alternative Gene Name: KIAA0027, LVM, MLC, VL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035805: 85%, ENSRNOG00000032871: 85%
Entrez Gene ID: 23209
Uniprot ID: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI |
| Documents & Links for Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) | |
| Datasheet | Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) at Atlas |
| Documents & Links for Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) | |
| Datasheet | Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLC1 pAb (ATL-HPA067533 w/enhanced validation) |