Description
Product Description
Protein Description: MAP kinase interacting serine/threonine kinase 2
Gene Name: MKNK2
Alternative Gene Name: GPRK7, MNK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020190: 77%, ENSRNOG00000029028: 79%
Entrez Gene ID: 2872
Uniprot ID: Q9HBH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MKNK2
Alternative Gene Name: GPRK7, MNK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020190: 77%, ENSRNOG00000029028: 79%
Entrez Gene ID: 2872
Uniprot ID: Q9HBH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ |
| Gene Sequence | AIAMNRQLAQHDEDLAEEEAAGQGQPVLVRATSRCLQLSPPSQSKLAQ |
| Gene ID - Mouse | ENSMUSG00000020190 |
| Gene ID - Rat | ENSRNOG00000029028 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti MKNK2 pAb (ATL-HPA070499) | |
| Datasheet | Anti MKNK2 pAb (ATL-HPA070499) Datasheet (External Link) |
| Vendor Page | Anti MKNK2 pAb (ATL-HPA070499) at Atlas Antibodies |
| Documents & Links for Anti MKNK2 pAb (ATL-HPA070499) | |
| Datasheet | Anti MKNK2 pAb (ATL-HPA070499) Datasheet (External Link) |
| Vendor Page | Anti MKNK2 pAb (ATL-HPA070499) |