Protein Description: MAP kinase interacting serine/threonine kinase 1
Gene Name: MKNK1
Alternative Gene Name: MNK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028708: 75%, ENSRNOG00000010381: 73%
Entrez Gene ID: 8569
Uniprot ID: Q9BUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MKNK1
Alternative Gene Name: MNK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028708: 75%, ENSRNOG00000010381: 73%
Entrez Gene ID: 8569
Uniprot ID: Q9BUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS |
Documents & Links for Anti MKNK1 pAb (ATL-HPA071293) | |
Datasheet | Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link) |
Vendor Page | Anti MKNK1 pAb (ATL-HPA071293) at Atlas |
Documents & Links for Anti MKNK1 pAb (ATL-HPA071293) | |
Datasheet | Anti MKNK1 pAb (ATL-HPA071293) Datasheet (External Link) |
Vendor Page | Anti MKNK1 pAb (ATL-HPA071293) |