Anti MISP pAb (ATL-HPA062232 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062232-25

• 
• 
• 

Product Description

Protein Description: mitotic spindle positioning
Gene Name: MISP
Alternative Gene Name: C19orf21, Caprice, DKFZp686H18209
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035852: 43%, ENSRNOG00000010423: 48%
Entrez Gene ID: 126353
Uniprot ID: Q8IVT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQGVQRQGVSYSVHAYTGQPSPRGLHSENREDEGWQVYR
• Gene Sequence: VLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQGVQRQGVSYSVHAYTGQPSPRGLHSENREDEGWQVYR
• Gene ID - Mouse: ENSMUSG00000035852
• Gene ID - Rat: ENSRNOG00000010423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.