Description
Product Description
Protein Description: MINDY lysine 48 deubiquitinase 1
Gene Name: MINDY1
Alternative Gene Name: FAM63A, FLJ11280, MINDY-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038712: 83%, ENSRNOG00000021131: 82%
Entrez Gene ID: 55793
Uniprot ID: Q8N5J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MINDY1
Alternative Gene Name: FAM63A, FLJ11280, MINDY-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038712: 83%, ENSRNOG00000021131: 82%
Entrez Gene ID: 55793
Uniprot ID: Q8N5J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLIALSLQQQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCI |
Gene Sequence | YLIALSLQQQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCI |
Gene ID - Mouse | ENSMUSG00000038712 |
Gene ID - Rat | ENSRNOG00000021131 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MINDY1 pAb (ATL-HPA061086) | |
Datasheet | Anti MINDY1 pAb (ATL-HPA061086) Datasheet (External Link) |
Vendor Page | Anti MINDY1 pAb (ATL-HPA061086) at Atlas Antibodies |
Documents & Links for Anti MINDY1 pAb (ATL-HPA061086) | |
Datasheet | Anti MINDY1 pAb (ATL-HPA061086) Datasheet (External Link) |
Vendor Page | Anti MINDY1 pAb (ATL-HPA061086) |