Protein Description: mesoderm induction early response 1, family member 3
Gene Name: MIER3
Alternative Gene Name: DKFZp686L09111, DKFZp781I1119, FLJ35954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032727: 94%, ENSRNOG00000013121: 95%
Entrez Gene ID: 166968
Uniprot ID: Q7Z3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MIER3
Alternative Gene Name: DKFZp686L09111, DKFZp781I1119, FLJ35954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032727: 94%, ENSRNOG00000013121: 95%
Entrez Gene ID: 166968
Uniprot ID: Q7Z3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE |
| Gene ID - Mouse | ENSMUSG00000032727 |
| Gene ID - Rat | ENSMUSG00000032727 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MIER3 pAb (ATL-HPA065946) | |
| Datasheet | Anti MIER3 pAb (ATL-HPA065946) Datasheet (External Link) |
| Vendor Page | Anti MIER3 pAb (ATL-HPA065946) at Atlas |
| Documents & Links for Anti MIER3 pAb (ATL-HPA065946) | |
| Datasheet | Anti MIER3 pAb (ATL-HPA065946) Datasheet (External Link) |
| Vendor Page | Anti MIER3 pAb (ATL-HPA065946) |