Anti MIER3 pAb (ATL-HPA065946)

Catalog No:
ATL-HPA065946-25
$447.00
Protein Description: mesoderm induction early response 1, family member 3
Gene Name: MIER3
Alternative Gene Name: DKFZp686L09111, DKFZp781I1119, FLJ35954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032727: 94%, ENSRNOG00000013121: 95%
Entrez Gene ID: 166968
Uniprot ID: Q7Z3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE
Gene ID - Mouse ENSMUSG00000032727
Gene ID - Rat ENSMUSG00000032727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MIER3 pAb (ATL-HPA065946)
Datasheet Anti MIER3 pAb (ATL-HPA065946) Datasheet (External Link)
Vendor Page Anti MIER3 pAb (ATL-HPA065946) at Atlas

Documents & Links for Anti MIER3 pAb (ATL-HPA065946)
Datasheet Anti MIER3 pAb (ATL-HPA065946) Datasheet (External Link)
Vendor Page Anti MIER3 pAb (ATL-HPA065946)