Anti MIEN1 pAb (ATL-HPA061344)

Atlas Antibodies

Catalog No: ATL-HPA061344-25

• 

Product Description

Protein Description: migration and invasion enhancer 1
Gene Name: MIEN1
Alternative Gene Name: C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002580: 94%, ENSRNOG00000007227: 96%
Entrez Gene ID: 84299
Uniprot ID: Q9BRT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
• Gene Sequence: GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
• Gene ID - Mouse: ENSMUSG00000002580
• Gene ID - Rat: ENSRNOG00000007227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.