Anti MICB pAb (ATL-HPA064618)

Catalog No:
ATL-HPA064618-25
$395.00

Description

Product Description

Protein Description: MHC class I polypeptide-related sequence B
Gene Name: MICB
Alternative Gene Name: PERB11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023030: 33%, ENSRNOG00000019550: 33%
Entrez Gene ID: 4277
Uniprot ID: Q29980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene Sequence CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene ID - Mouse ENSMUSG00000023030
Gene ID - Rat ENSRNOG00000019550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618) at Atlas Antibodies

Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618)

Product Description

Protein Description: MHC class I polypeptide-related sequence B
Gene Name: MICB
Alternative Gene Name: PERB11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023030: 33%, ENSRNOG00000019550: 33%
Entrez Gene ID: 4277
Uniprot ID: Q29980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene Sequence CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Gene ID - Mouse ENSMUSG00000023030
Gene ID - Rat ENSRNOG00000019550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618) at Atlas Antibodies

Documents & Links for Anti MICB pAb (ATL-HPA064618)
Datasheet Anti MICB pAb (ATL-HPA064618) Datasheet (External Link)
Vendor Page Anti MICB pAb (ATL-HPA064618)