Description
Product Description
Protein Description: mindbomb E3 ubiquitin protein ligase 2
Gene Name: MIB2
Alternative Gene Name: FLJ39787, skeletrophin, ZZANK1, ZZZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029060: 93%, ENSRNOG00000017564: 93%
Entrez Gene ID: 142678
Uniprot ID: Q96AX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MIB2
Alternative Gene Name: FLJ39787, skeletrophin, ZZANK1, ZZZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029060: 93%, ENSRNOG00000017564: 93%
Entrez Gene ID: 142678
Uniprot ID: Q96AX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ |
Gene Sequence | PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ |
Gene ID - Mouse | ENSMUSG00000029060 |
Gene ID - Rat | ENSRNOG00000017564 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) | |
Datasheet | Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) | |
Datasheet | Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MIB2 pAb (ATL-HPA068322 w/enhanced validation) |