Anti MIA3 pAb (ATL-HPA056816 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056816-25

• 
• 

Product Description

Protein Description: melanoma inhibitory activity family, member 3
Gene Name: MIA3
Alternative Gene Name: FLJ39207, KIAA0268, TANGO, UNQ6077
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027961: 25%, ENSRNOG00000059202: 54%
Entrez Gene ID: 375056
Uniprot ID: Q5JRA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
• Gene Sequence: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
• Gene ID - Mouse: ENSMUSG00000027961
• Gene ID - Rat: ENSRNOG00000059202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti MIA3 pAb (ATL-HPA056816 w/enhanced validation) – 1 Found

McCaughey, Janine; Stevenson, Nicola L; Mantell, Judith M; Neal, Chris R; Paterson, Alex; Heesom, Kate; Stephens, David J. A general role for TANGO1, encoded by MIA3, in secretory pathway organization and function. Journal Of Cell Science. 2021;134(17)