Description
Product Description
Protein Description: microsomal glutathione S-transferase 3
Gene Name: MGST3
Alternative Gene Name: GST-III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026688: 90%, ENSRNOG00000004245: 90%
Entrez Gene ID: 4259
Uniprot ID: O14880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MGST3
Alternative Gene Name: GST-III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026688: 90%, ENSRNOG00000004245: 90%
Entrez Gene ID: 4259
Uniprot ID: O14880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | INVSKARKKYKVEYPIMYSTDPENGHIFNC |
Gene Sequence | INVSKARKKYKVEYPIMYSTDPENGHIFNC |
Gene ID - Mouse | ENSMUSG00000026688 |
Gene ID - Rat | ENSRNOG00000004245 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) | |
Datasheet | Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) | |
Datasheet | Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MGST3 pAb (ATL-HPA077929 w/enhanced validation) |