Protein Description: O-6-methylguanine-DNA methyltransferase
Gene Name: MGMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054612: 59%, ENSRNOG00000016038: 61%
Entrez Gene ID: 4255
Uniprot ID: P16455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MGMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054612: 59%, ENSRNOG00000016038: 61%
Entrez Gene ID: 4255
Uniprot ID: P16455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE |
| Documents & Links for Anti MGMT pAb (ATL-HPA069497) | |
| Datasheet | Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link) |
| Vendor Page | Anti MGMT pAb (ATL-HPA069497) at Atlas |
| Documents & Links for Anti MGMT pAb (ATL-HPA069497) | |
| Datasheet | Anti MGMT pAb (ATL-HPA069497) Datasheet (External Link) |
| Vendor Page | Anti MGMT pAb (ATL-HPA069497) |
| Citations for Anti MGMT pAb (ATL-HPA069497) – 1 Found |
| Stoyanov, George S; Lyutfi, Emran; Georgieva, Reneta; Georgiev, Radoslav; Dzhenkov, Deyan L; Petkova, Lilyana; Ivanov, Borislav D; Kaprelyan, Ara; Ghenev, Peter. Reclassification of Glioblastoma Multiforme According to the 2021 World Health Organization Classification of Central Nervous System Tumors: A Single Institution Report and Practical Significance. Cureus. 2022;14(2):e21822. PubMed |