Protein Description: meningioma expressed antigen 5 (hyaluronidase)
Gene Name: MGEA5
Alternative Gene Name: MEA5, NCOAT, OGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025220: 96%, ENSRNOG00000017822: 96%
Entrez Gene ID: 10724
Uniprot ID: O60502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MGEA5
Alternative Gene Name: MEA5, NCOAT, OGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025220: 96%, ENSRNOG00000017822: 96%
Entrez Gene ID: 10724
Uniprot ID: O60502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD |
| Documents & Links for Anti MGEA5 pAb (ATL-HPA076501) | |
| Datasheet | Anti MGEA5 pAb (ATL-HPA076501) Datasheet (External Link) |
| Vendor Page | Anti MGEA5 pAb (ATL-HPA076501) at Atlas |
| Documents & Links for Anti MGEA5 pAb (ATL-HPA076501) | |
| Datasheet | Anti MGEA5 pAb (ATL-HPA076501) Datasheet (External Link) |
| Vendor Page | Anti MGEA5 pAb (ATL-HPA076501) |