Anti MGEA5 pAb (ATL-HPA076501)

Catalog No:
ATL-HPA076501-25
$395.00
Protein Description: meningioma expressed antigen 5 (hyaluronidase)
Gene Name: MGEA5
Alternative Gene Name: MEA5, NCOAT, OGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025220: 96%, ENSRNOG00000017822: 96%
Entrez Gene ID: 10724
Uniprot ID: O60502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence DCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
Gene ID - Mouse ENSMUSG00000025220
Gene ID - Rat ENSMUSG00000025220
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MGEA5 pAb (ATL-HPA076501)
Datasheet Anti MGEA5 pAb (ATL-HPA076501) Datasheet (External Link)
Vendor Page Anti MGEA5 pAb (ATL-HPA076501) at Atlas

Documents & Links for Anti MGEA5 pAb (ATL-HPA076501)
Datasheet Anti MGEA5 pAb (ATL-HPA076501) Datasheet (External Link)
Vendor Page Anti MGEA5 pAb (ATL-HPA076501)