Anti MGAT2 pAb (ATL-HPA056824)

Catalog No:
ATL-HPA056824-25
$447.00

Description

Product Description

Protein Description: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
Gene Name: MGAT2
Alternative Gene Name: GNT-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043998: 99%, ENSRNOG00000004234: 97%
Entrez Gene ID: 4247
Uniprot ID: Q10469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER
Gene Sequence QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER
Gene ID - Mouse ENSMUSG00000043998
Gene ID - Rat ENSRNOG00000004234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MGAT2 pAb (ATL-HPA056824)
Datasheet Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA056824) at Atlas Antibodies

Documents & Links for Anti MGAT2 pAb (ATL-HPA056824)
Datasheet Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA056824)

Product Description

Protein Description: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
Gene Name: MGAT2
Alternative Gene Name: GNT-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043998: 99%, ENSRNOG00000004234: 97%
Entrez Gene ID: 4247
Uniprot ID: Q10469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER
Gene Sequence QVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWER
Gene ID - Mouse ENSMUSG00000043998
Gene ID - Rat ENSRNOG00000004234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MGAT2 pAb (ATL-HPA056824)
Datasheet Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA056824) at Atlas Antibodies

Documents & Links for Anti MGAT2 pAb (ATL-HPA056824)
Datasheet Anti MGAT2 pAb (ATL-HPA056824) Datasheet (External Link)
Vendor Page Anti MGAT2 pAb (ATL-HPA056824)