Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)

Catalog No:
ATL-HPA055697-25
$447.00

Description

Product Description

Protein Description: maltase-glucoamylase 2 (putative)
Gene Name: MGAM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027790: 45%, ENSRNOG00000031067: 47%
Entrez Gene ID: 93432
Uniprot ID: Q2M2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
Gene Sequence PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
Gene ID - Mouse ENSMUSG00000027790
Gene ID - Rat ENSRNOG00000031067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)
Datasheet Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)
Datasheet Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)

Product Description

Protein Description: maltase-glucoamylase 2 (putative)
Gene Name: MGAM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027790: 45%, ENSRNOG00000031067: 47%
Entrez Gene ID: 93432
Uniprot ID: Q2M2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
Gene Sequence PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
Gene ID - Mouse ENSMUSG00000027790
Gene ID - Rat ENSRNOG00000031067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)
Datasheet Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)
Datasheet Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)