Anti MGAM2 pAb (ATL-HPA055697 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA055697-25

• 
• 

Product Description

Protein Description: maltase-glucoamylase 2 (putative)
Gene Name: MGAM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027790: 45%, ENSRNOG00000031067: 47%
Entrez Gene ID: 93432
Uniprot ID: Q2M2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
• Gene Sequence: PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
• Gene ID - Mouse: ENSMUSG00000027790
• Gene ID - Rat: ENSRNOG00000031067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.