Anti MFSD9 pAb (ATL-HPA061859)

Atlas Antibodies

Catalog No: ATL-HPA061859-25

• 

Product Description

Protein Description: major facilitator superfamily domain containing 9
Gene Name: MFSD9
Alternative Gene Name: MGC11332
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041945: 41%, ENSRNOG00000023129: 38%
Entrez Gene ID: 84804
Uniprot ID: Q8NBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLF
• Gene Sequence: PGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLF
• Gene ID - Mouse: ENSMUSG00000041945
• Gene ID - Rat: ENSRNOG00000023129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.