Protein Description: major facilitator superfamily domain containing 6-like
Gene Name: MFSD6L
Alternative Gene Name: FLJ35773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048329: 39%, ENSRNOG00000037712: 39%
Entrez Gene ID: 162387
Uniprot ID: Q8IWD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MFSD6L
Alternative Gene Name: FLJ35773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048329: 39%, ENSRNOG00000037712: 39%
Entrez Gene ID: 162387
Uniprot ID: Q8IWD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGARTTS |
| Documents & Links for Anti MFSD6L pAb (ATL-HPA023164) | |
| Datasheet | Anti MFSD6L pAb (ATL-HPA023164) Datasheet (External Link) |
| Vendor Page | Anti MFSD6L pAb (ATL-HPA023164) at Atlas |
| Documents & Links for Anti MFSD6L pAb (ATL-HPA023164) | |
| Datasheet | Anti MFSD6L pAb (ATL-HPA023164) Datasheet (External Link) |
| Vendor Page | Anti MFSD6L pAb (ATL-HPA023164) |
| Citations for Anti MFSD6L pAb (ATL-HPA023164) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |