![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/98787/178094/atl-hpa062306_anti-mfap3l-pab-atl-hpa062306_59756__49464.1681133460.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: microfibril associated protein 3 like
Gene Name: MFAP3L
Alternative Gene Name: KIAA0626, NYD-sp9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031647: 79%, ENSRNOG00000011775: 76%
Entrez Gene ID: 9848
Uniprot ID: O75121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MFAP3L
Alternative Gene Name: KIAA0626, NYD-sp9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031647: 79%, ENSRNOG00000011775: 76%
Entrez Gene ID: 9848
Uniprot ID: O75121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QEGGQFEVKDVEETELSAEHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESH |
| Documents & Links for Anti MFAP3L pAb (ATL-HPA062306) | |
| Datasheet | Anti MFAP3L pAb (ATL-HPA062306) Datasheet (External Link) |
| Vendor Page | Anti MFAP3L pAb (ATL-HPA062306) at Atlas |
| Documents & Links for Anti MFAP3L pAb (ATL-HPA062306) | |
| Datasheet | Anti MFAP3L pAb (ATL-HPA062306) Datasheet (External Link) |
| Vendor Page | Anti MFAP3L pAb (ATL-HPA062306) |