Protein Description: mex-3 RNA binding family member D
Gene Name: MEX3D
Alternative Gene Name: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048696: 77%, ENSRNOG00000030830: 77%
Entrez Gene ID: 399664
Uniprot ID: Q86XN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MEX3D
Alternative Gene Name: KIAA2031, OK/SW-cl.4, RKHD1, RNF193, Tino
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048696: 77%, ENSRNOG00000030830: 77%
Entrez Gene ID: 399664
Uniprot ID: Q86XN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DVFAGFAPHPAALGPPTLLADQMSVICGRKK |
Documents & Links for Anti MEX3D pAb (ATL-HPA065385) | |
Datasheet | Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link) |
Vendor Page | Anti MEX3D pAb (ATL-HPA065385) at Atlas |
Documents & Links for Anti MEX3D pAb (ATL-HPA065385) | |
Datasheet | Anti MEX3D pAb (ATL-HPA065385) Datasheet (External Link) |
Vendor Page | Anti MEX3D pAb (ATL-HPA065385) |