Description
Product Description
Protein Description: mex-3 RNA binding family member A
Gene Name: MEX3A
Alternative Gene Name: RKHD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074480: 91%, ENSRNOG00000058654: 91%
Entrez Gene ID: 92312
Uniprot ID: A1L020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MEX3A
Alternative Gene Name: RKHD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074480: 91%, ENSRNOG00000058654: 91%
Entrez Gene ID: 92312
Uniprot ID: A1L020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI |
Gene Sequence | THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI |
Gene ID - Mouse | ENSMUSG00000074480 |
Gene ID - Rat | ENSRNOG00000058654 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MEX3A pAb (ATL-HPA062703) | |
Datasheet | Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link) |
Vendor Page | Anti MEX3A pAb (ATL-HPA062703) at Atlas Antibodies |
Documents & Links for Anti MEX3A pAb (ATL-HPA062703) | |
Datasheet | Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link) |
Vendor Page | Anti MEX3A pAb (ATL-HPA062703) |
Citations
Citations for Anti MEX3A pAb (ATL-HPA062703) – 2 Found |
Panzeri, Valentina; Manni, Isabella; Capone, Alessia; Naro, Chiara; Sacconi, Andrea; Di Agostino, Silvia; de Latouliere, Luisa; Montori, Andrea; Pilozzi, Emanuela; Piaggio, Giulia; Capurso, Gabriele; Sette, Claudio. The RNA-binding protein MEX3A is a prognostic factor and regulator of resistance to gemcitabine in pancreatic ductal adenocarcinoma. Molecular Oncology. 2021;15(2):579-595. PubMed |
Qiu, Yuntan; Meng, Meng; Cao, Chuanzhen; Zhang, Jingyuan; Cheng, Xu; Huang, Yongxin; Cao, Haotian; Li, Yun; Tian, Duanqing; Huang, Yongsheng; Peng, Li; Hu, Kaishun; Zhang, Yin; Liao, Jianyou; He, Jiehua; Wang, Xiaochun; Lu, Daning; Lin, Lehang; Bi, Xingang; Yin, Dong. RNA-binding protein MEX3A controls G1/S transition via regulating the RB/E2F pathway in clear cell renal cell carcinoma. Molecular Therapy. Nucleic Acids. 2022;27( 34976441):241-255. PubMed |