Anti MEX3A pAb (ATL-HPA062703)

Catalog No:
ATL-HPA062703-25
$303.00

Description

Product Description

Protein Description: mex-3 RNA binding family member A
Gene Name: MEX3A
Alternative Gene Name: RKHD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074480: 91%, ENSRNOG00000058654: 91%
Entrez Gene ID: 92312
Uniprot ID: A1L020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI
Gene Sequence THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI
Gene ID - Mouse ENSMUSG00000074480
Gene ID - Rat ENSRNOG00000058654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MEX3A pAb (ATL-HPA062703)
Datasheet Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link)
Vendor Page Anti MEX3A pAb (ATL-HPA062703) at Atlas Antibodies

Documents & Links for Anti MEX3A pAb (ATL-HPA062703)
Datasheet Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link)
Vendor Page Anti MEX3A pAb (ATL-HPA062703)

Citations

Citations for Anti MEX3A pAb (ATL-HPA062703) – 2 Found
Panzeri, Valentina; Manni, Isabella; Capone, Alessia; Naro, Chiara; Sacconi, Andrea; Di Agostino, Silvia; de Latouliere, Luisa; Montori, Andrea; Pilozzi, Emanuela; Piaggio, Giulia; Capurso, Gabriele; Sette, Claudio. The RNA-binding protein MEX3A is a prognostic factor and regulator of resistance to gemcitabine in pancreatic ductal adenocarcinoma. Molecular Oncology. 2021;15(2):579-595.  PubMed
Qiu, Yuntan; Meng, Meng; Cao, Chuanzhen; Zhang, Jingyuan; Cheng, Xu; Huang, Yongxin; Cao, Haotian; Li, Yun; Tian, Duanqing; Huang, Yongsheng; Peng, Li; Hu, Kaishun; Zhang, Yin; Liao, Jianyou; He, Jiehua; Wang, Xiaochun; Lu, Daning; Lin, Lehang; Bi, Xingang; Yin, Dong. RNA-binding protein MEX3A controls G1/S transition via regulating the RB/E2F pathway in clear cell renal cell carcinoma. Molecular Therapy. Nucleic Acids. 2022;27( 34976441):241-255.  PubMed

Product Description

Protein Description: mex-3 RNA binding family member A
Gene Name: MEX3A
Alternative Gene Name: RKHD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074480: 91%, ENSRNOG00000058654: 91%
Entrez Gene ID: 92312
Uniprot ID: A1L020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI
Gene Sequence THIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCI
Gene ID - Mouse ENSMUSG00000074480
Gene ID - Rat ENSRNOG00000058654
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MEX3A pAb (ATL-HPA062703)
Datasheet Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link)
Vendor Page Anti MEX3A pAb (ATL-HPA062703) at Atlas Antibodies

Documents & Links for Anti MEX3A pAb (ATL-HPA062703)
Datasheet Anti MEX3A pAb (ATL-HPA062703) Datasheet (External Link)
Vendor Page Anti MEX3A pAb (ATL-HPA062703)

Citations

Citations for Anti MEX3A pAb (ATL-HPA062703) – 2 Found
Panzeri, Valentina; Manni, Isabella; Capone, Alessia; Naro, Chiara; Sacconi, Andrea; Di Agostino, Silvia; de Latouliere, Luisa; Montori, Andrea; Pilozzi, Emanuela; Piaggio, Giulia; Capurso, Gabriele; Sette, Claudio. The RNA-binding protein MEX3A is a prognostic factor and regulator of resistance to gemcitabine in pancreatic ductal adenocarcinoma. Molecular Oncology. 2021;15(2):579-595.  PubMed
Qiu, Yuntan; Meng, Meng; Cao, Chuanzhen; Zhang, Jingyuan; Cheng, Xu; Huang, Yongxin; Cao, Haotian; Li, Yun; Tian, Duanqing; Huang, Yongsheng; Peng, Li; Hu, Kaishun; Zhang, Yin; Liao, Jianyou; He, Jiehua; Wang, Xiaochun; Lu, Daning; Lin, Lehang; Bi, Xingang; Yin, Dong. RNA-binding protein MEX3A controls G1/S transition via regulating the RB/E2F pathway in clear cell renal cell carcinoma. Molecular Therapy. Nucleic Acids. 2022;27( 34976441):241-255.  PubMed