Protein Description: methyltransferase like 27
Gene Name: METTL27
Alternative Gene Name: WBSCR27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040557: 80%, ENSRNOG00000046700: 78%
Entrez Gene ID: 155368
Uniprot ID: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: METTL27
Alternative Gene Name: WBSCR27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040557: 80%, ENSRNOG00000046700: 78%
Entrez Gene ID: 155368
Uniprot ID: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL |
Documents & Links for Anti METTL27 pAb (ATL-HPA074662) | |
Datasheet | Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link) |
Vendor Page | Anti METTL27 pAb (ATL-HPA074662) at Atlas |
Documents & Links for Anti METTL27 pAb (ATL-HPA074662) | |
Datasheet | Anti METTL27 pAb (ATL-HPA074662) Datasheet (External Link) |
Vendor Page | Anti METTL27 pAb (ATL-HPA074662) |