Anti METTL27 pAb (ATL-HPA074662)

Atlas Antibodies

Catalog No: ATL-HPA074662-25

• 

Product Description

Protein Description: methyltransferase like 27
Gene Name: METTL27
Alternative Gene Name: WBSCR27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040557: 80%, ENSRNOG00000046700: 78%
Entrez Gene ID: 155368
Uniprot ID: Q8N6F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
• Gene Sequence: RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
• Gene ID - Mouse: ENSMUSG00000040557
• Gene ID - Rat: ENSRNOG00000046700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.