Protein Description: methyltransferase like 22
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 82%, ENSRNOG00000002714: 82%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 82%, ENSRNOG00000002714: 82%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NACTAILSVEKRLNFTLRHLDVTCEAYDHFRSCLHALEQLTDGKLRFVVEPVEASFPQLLVYERLQQLELWKIIAEP |
Documents & Links for Anti METTL22 pAb (ATL-HPA074173) | |
Datasheet | Anti METTL22 pAb (ATL-HPA074173) Datasheet (External Link) |
Vendor Page | Anti METTL22 pAb (ATL-HPA074173) at Atlas |
Documents & Links for Anti METTL22 pAb (ATL-HPA074173) | |
Datasheet | Anti METTL22 pAb (ATL-HPA074173) Datasheet (External Link) |
Vendor Page | Anti METTL22 pAb (ATL-HPA074173) |