Anti METTL22 pAb (ATL-HPA059882)

Atlas Antibodies

Catalog No: ATL-HPA059882-25

• 

Product Description

Protein Description: methyltransferase like 22
Gene Name: METTL22
Alternative Gene Name: C16orf68, FLJ12433, MGC2654
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039345: 80%, ENSRNOG00000002714: 80%
Entrez Gene ID: 79091
Uniprot ID: Q9BUU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQV
• Gene Sequence: DEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIEHTMATPLEDVGKQV
• Gene ID - Mouse: ENSMUSG00000039345
• Gene ID - Rat: ENSRNOG00000002714
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.