Anti METTL17 pAb (ATL-HPA059802)

Atlas Antibodies

Catalog No: ATL-HPA059802-25

• 
• 

Product Description

Protein Description: methyltransferase like 17
Gene Name: METTL17
Alternative Gene Name: FLJ20859, METT11D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004561: 89%, ENSRNOG00000025512: 88%
Entrez Gene ID: 64745
Uniprot ID: Q9H7H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL
• Gene Sequence: DPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPVL
• Gene ID - Mouse: ENSMUSG00000004561
• Gene ID - Rat: ENSRNOG00000025512
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.