Protein Description: mesoderm development candidate 1
Gene Name: MESDC1
Alternative Gene Name: MGC99595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070462: 98%, ENSRNOG00000012349: 98%
Entrez Gene ID: 59274
Uniprot ID: Q9H1K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MESDC1
Alternative Gene Name: MGC99595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070462: 98%, ENSRNOG00000012349: 98%
Entrez Gene ID: 59274
Uniprot ID: Q9H1K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN |
| Documents & Links for Anti MESDC1 pAb (ATL-HPA071716) | |
| Datasheet | Anti MESDC1 pAb (ATL-HPA071716) Datasheet (External Link) |
| Vendor Page | Anti MESDC1 pAb (ATL-HPA071716) at Atlas |
| Documents & Links for Anti MESDC1 pAb (ATL-HPA071716) | |
| Datasheet | Anti MESDC1 pAb (ATL-HPA071716) Datasheet (External Link) |
| Vendor Page | Anti MESDC1 pAb (ATL-HPA071716) |