Anti MESDC1 pAb (ATL-HPA071716)

Atlas Antibodies

Catalog No: ATL-HPA071716-25

• 

Product Description

Protein Description: mesoderm development candidate 1
Gene Name: MESDC1
Alternative Gene Name: MGC99595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070462: 98%, ENSRNOG00000012349: 98%
Entrez Gene ID: 59274
Uniprot ID: Q9H1K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN
• Gene Sequence: LLTQCLRDLAQHPDGGAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN
• Gene ID - Mouse: ENSMUSG00000070462
• Gene ID - Rat: ENSRNOG00000012349
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.