Protein Description: MER proto-oncogene, tyrosine kinase
Gene Name: MERTK
Alternative Gene Name: c-Eyk, mer, RP38, Tyro12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014361: 82%, ENSRNOG00000017319: 83%
Entrez Gene ID: 10461
Uniprot ID: Q12866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MERTK
Alternative Gene Name: c-Eyk, mer, RP38, Tyro12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014361: 82%, ENSRNOG00000017319: 83%
Entrez Gene ID: 10461
Uniprot ID: Q12866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA |
Documents & Links for Anti MERTK pAb (ATL-HPA075622) | |
Datasheet | Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link) |
Vendor Page | Anti MERTK pAb (ATL-HPA075622) at Atlas |
Documents & Links for Anti MERTK pAb (ATL-HPA075622) | |
Datasheet | Anti MERTK pAb (ATL-HPA075622) Datasheet (External Link) |
Vendor Page | Anti MERTK pAb (ATL-HPA075622) |