Anti MEMO1 pAb (ATL-HPA057952)

Atlas Antibodies

Catalog No: ATL-HPA057952-25

• 

Product Description

Protein Description: mediator of cell motility 1
Gene Name: MEMO1
Alternative Gene Name: C2orf4, CGI-27, MEMO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058704: 99%, ENSRNOG00000006340: 73%
Entrez Gene ID: 51072
Uniprot ID: Q9Y316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI
• Gene Sequence: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRI
• Gene ID - Mouse: ENSMUSG00000058704
• Gene ID - Rat: ENSRNOG00000006340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.