Protein Description: mediator complex subunit 7
Gene Name: MED7
Alternative Gene Name: CRSP33, CRSP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020397: 100%, ENSRNOG00000007053: 100%
Entrez Gene ID: 9443
Uniprot ID: O43513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED7
Alternative Gene Name: CRSP33, CRSP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020397: 100%, ENSRNOG00000007053: 100%
Entrez Gene ID: 9443
Uniprot ID: O43513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI |
| Documents & Links for Anti MED7 pAb (ATL-HPA067181) | |
| Datasheet | Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link) |
| Vendor Page | Anti MED7 pAb (ATL-HPA067181) at Atlas |
| Documents & Links for Anti MED7 pAb (ATL-HPA067181) | |
| Datasheet | Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link) |
| Vendor Page | Anti MED7 pAb (ATL-HPA067181) |