Protein Description: mediator complex subunit 23
Gene Name: MED23
Alternative Gene Name: CRSP130, CRSP3, DRIP130, Sur2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019984: 100%, ENSRNOG00000013422: 100%
Entrez Gene ID: 9439
Uniprot ID: Q9ULK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED23
Alternative Gene Name: CRSP130, CRSP3, DRIP130, Sur2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019984: 100%, ENSRNOG00000013422: 100%
Entrez Gene ID: 9439
Uniprot ID: Q9ULK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG |
| Documents & Links for Anti MED23 pAb (ATL-HPA070341) | |
| Datasheet | Anti MED23 pAb (ATL-HPA070341) Datasheet (External Link) |
| Vendor Page | Anti MED23 pAb (ATL-HPA070341) at Atlas |
| Documents & Links for Anti MED23 pAb (ATL-HPA070341) | |
| Datasheet | Anti MED23 pAb (ATL-HPA070341) Datasheet (External Link) |
| Vendor Page | Anti MED23 pAb (ATL-HPA070341) |