Anti MED17 pAb (ATL-HPA064236)

Atlas Antibodies

Catalog No: ATL-HPA064236-25

• 

Product Description

Protein Description: mediator complex subunit 17
Gene Name: MED17
Alternative Gene Name: CRSP6, CRSP77, DRIP80, TRAP80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031935: 99%, ENSRNOG00000010496: 99%
Entrez Gene ID: 9440
Uniprot ID: Q9NVC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR
• Gene Sequence: RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR
• Gene ID - Mouse: ENSMUSG00000031935
• Gene ID - Rat: ENSRNOG00000010496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.