Protein Description: mediator complex subunit 14
Gene Name: MED14
Alternative Gene Name: CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064127: 100%, ENSRNOG00000003792: 100%
Entrez Gene ID: 9282
Uniprot ID: O60244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED14
Alternative Gene Name: CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064127: 100%, ENSRNOG00000003792: 100%
Entrez Gene ID: 9282
Uniprot ID: O60244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP |
Documents & Links for Anti MED14 pAb (ATL-HPA064182) | |
Datasheet | Anti MED14 pAb (ATL-HPA064182) Datasheet (External Link) |
Vendor Page | Anti MED14 pAb (ATL-HPA064182) at Atlas |
Documents & Links for Anti MED14 pAb (ATL-HPA064182) | |
Datasheet | Anti MED14 pAb (ATL-HPA064182) Datasheet (External Link) |
Vendor Page | Anti MED14 pAb (ATL-HPA064182) |