Protein Description: mediator complex subunit 13
Gene Name: MED13
Alternative Gene Name: KIAA0593, THRAP1, TRAP240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034297: 97%, ENSRNOG00000003679: 97%
Entrez Gene ID: 9969
Uniprot ID: Q9UHV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MED13
Alternative Gene Name: KIAA0593, THRAP1, TRAP240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034297: 97%, ENSRNOG00000003679: 97%
Entrez Gene ID: 9969
Uniprot ID: Q9UHV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH |
| Documents & Links for Anti MED13 pAb (ATL-HPA067939) | |
| Datasheet | Anti MED13 pAb (ATL-HPA067939) Datasheet (External Link) |
| Vendor Page | Anti MED13 pAb (ATL-HPA067939) at Atlas |
| Documents & Links for Anti MED13 pAb (ATL-HPA067939) | |
| Datasheet | Anti MED13 pAb (ATL-HPA067939) Datasheet (External Link) |
| Vendor Page | Anti MED13 pAb (ATL-HPA067939) |