Description
Product Description
Protein Description: mucolipin 3
Gene Name: MCOLN3
Alternative Gene Name: FLJ11006, TRP-ML3, TRPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036853: 88%, ENSRNOG00000015024: 86%
Entrez Gene ID: 55283
Uniprot ID: Q8TDD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MCOLN3
Alternative Gene Name: FLJ11006, TRP-ML3, TRPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036853: 88%, ENSRNOG00000015024: 86%
Entrez Gene ID: 55283
Uniprot ID: Q8TDD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY |
Gene Sequence | KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY |
Gene ID - Mouse | ENSMUSG00000036853 |
Gene ID - Rat | ENSRNOG00000015024 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) | |
Datasheet | Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) | |
Datasheet | Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) |