Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062137-25

• 

Product Description

Protein Description: mucolipin 3
Gene Name: MCOLN3
Alternative Gene Name: FLJ11006, TRP-ML3, TRPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036853: 88%, ENSRNOG00000015024: 86%
Entrez Gene ID: 55283
Uniprot ID: Q8TDD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY
• Gene Sequence: KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY
• Gene ID - Mouse: ENSMUSG00000036853
• Gene ID - Rat: ENSRNOG00000015024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.