Description
Product Description
Protein Description: mucolipin 1
Gene Name: MCOLN1
Alternative Gene Name: ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004567: 89%, ENSRNOG00000000975: 90%
Entrez Gene ID: 57192
Uniprot ID: Q9GZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MCOLN1
Alternative Gene Name: ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004567: 89%, ENSRNOG00000000975: 90%
Entrez Gene ID: 57192
Uniprot ID: Q9GZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDC |
Gene Sequence | FLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDC |
Gene ID - Mouse | ENSMUSG00000004567 |
Gene ID - Rat | ENSRNOG00000000975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MCOLN1 pAb (ATL-HPA069495) | |
Datasheet | Anti MCOLN1 pAb (ATL-HPA069495) Datasheet (External Link) |
Vendor Page | Anti MCOLN1 pAb (ATL-HPA069495) at Atlas Antibodies |
Documents & Links for Anti MCOLN1 pAb (ATL-HPA069495) | |
Datasheet | Anti MCOLN1 pAb (ATL-HPA069495) Datasheet (External Link) |
Vendor Page | Anti MCOLN1 pAb (ATL-HPA069495) |