Protein Description: minichromosome maintenance 10 replication initiation factor
Gene Name: MCM10
Alternative Gene Name: CNA43, DNA43, PRO2249
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026669: 84%, ENSRNOG00000017981: 88%
Entrez Gene ID: 55388
Uniprot ID: Q7L590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MCM10
Alternative Gene Name: CNA43, DNA43, PRO2249
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026669: 84%, ENSRNOG00000017981: 88%
Entrez Gene ID: 55388
Uniprot ID: Q7L590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK |
| Documents & Links for Anti MCM10 pAb (ATL-HPA071952) | |
| Datasheet | Anti MCM10 pAb (ATL-HPA071952) Datasheet (External Link) |
| Vendor Page | Anti MCM10 pAb (ATL-HPA071952) at Atlas |
| Documents & Links for Anti MCM10 pAb (ATL-HPA071952) | |
| Datasheet | Anti MCM10 pAb (ATL-HPA071952) Datasheet (External Link) |
| Vendor Page | Anti MCM10 pAb (ATL-HPA071952) |