Anti MCM10 pAb (ATL-HPA071952)

Atlas Antibodies

Catalog No: ATL-HPA071952-25

• 

Product Description

Protein Description: minichromosome maintenance 10 replication initiation factor
Gene Name: MCM10
Alternative Gene Name: CNA43, DNA43, PRO2249
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026669: 84%, ENSRNOG00000017981: 88%
Entrez Gene ID: 55388
Uniprot ID: Q7L590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
• Gene Sequence: REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
• Gene ID - Mouse: ENSMUSG00000026669
• Gene ID - Rat: ENSRNOG00000017981
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.