Description
Product Description
Protein Description: methylcrotonoyl-CoA carboxylase 2 (beta)
Gene Name: MCCC2
Alternative Gene Name: MCCB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021646: 94%, ENSRNOG00000017752: 93%
Entrez Gene ID: 64087
Uniprot ID: Q9HCC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MCCC2
Alternative Gene Name: MCCB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021646: 94%, ENSRNOG00000017752: 93%
Entrez Gene ID: 64087
Uniprot ID: Q9HCC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVRKQGTIFLAGP |
Gene Sequence | LPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVRKQGTIFLAGP |
Gene ID - Mouse | ENSMUSG00000021646 |
Gene ID - Rat | ENSRNOG00000017752 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) | |
Datasheet | Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) | |
Datasheet | Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MCCC2 pAb (ATL-HPA061546 w/enhanced validation) |