Anti MBP pAb (ATL-HPA064368)

Catalog No:
ATL-HPA064368-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: myelin basic protein
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP
Gene ID - Mouse ENSMUSG00000041607
Gene ID - Rat ENSMUSG00000041607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MBP pAb (ATL-HPA064368)
Datasheet Anti MBP pAb (ATL-HPA064368) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA064368) at Atlas

Documents & Links for Anti MBP pAb (ATL-HPA064368)
Datasheet Anti MBP pAb (ATL-HPA064368) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA064368)