Protein Description: myelin basic protein
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP |
| Documents & Links for Anti MBP pAb (ATL-HPA064368) | |
| Datasheet | Anti MBP pAb (ATL-HPA064368) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA064368) at Atlas |
| Documents & Links for Anti MBP pAb (ATL-HPA064368) | |
| Datasheet | Anti MBP pAb (ATL-HPA064368) Datasheet (External Link) |
| Vendor Page | Anti MBP pAb (ATL-HPA064368) |