Protein Description: myelin basic protein
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP |
Gene Sequence | ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP |
Gene ID - Mouse | ENSMUSG00000041607 |
Gene ID - Rat | ENSRNOG00000016516 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MBP pAb (ATL-HPA064368) | |
Datasheet | Anti MBP pAb (ATL-HPA064368) Datasheet (External Link) |
Vendor Page | Anti MBP pAb (ATL-HPA064368) at Atlas Antibodies |
Documents & Links for Anti MBP pAb (ATL-HPA064368) | |
Datasheet | Anti MBP pAb (ATL-HPA064368) Datasheet (External Link) |
Vendor Page | Anti MBP pAb (ATL-HPA064368) |