Description
Product Description
Protein Description: muscleblind-like splicing regulator 2
Gene Name: MBNL2
Alternative Gene Name: MBLL, MBLL39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022139: 96%, ENSRNOG00000010737: 96%
Entrez Gene ID: 10150
Uniprot ID: Q5VZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBNL2
Alternative Gene Name: MBLL, MBLL39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022139: 96%, ENSRNOG00000010737: 96%
Entrez Gene ID: 10150
Uniprot ID: Q5VZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV |
| Gene Sequence | AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV |
| Gene ID - Mouse | ENSMUSG00000022139 |
| Gene ID - Rat | ENSRNOG00000010737 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti MBNL2 pAb (ATL-HPA062685) | |
| Datasheet | Anti MBNL2 pAb (ATL-HPA062685) Datasheet (External Link) |
| Vendor Page | Anti MBNL2 pAb (ATL-HPA062685) at Atlas Antibodies |
| Documents & Links for Anti MBNL2 pAb (ATL-HPA062685) | |
| Datasheet | Anti MBNL2 pAb (ATL-HPA062685) Datasheet (External Link) |
| Vendor Page | Anti MBNL2 pAb (ATL-HPA062685) |