Protein Description: metallo-beta-lactamase domain containing 1
Gene Name: MBLAC1
Alternative Gene Name: MGC49416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049285: 85%, ENSRNOG00000001357: 85%
Entrez Gene ID: 255374
Uniprot ID: A4D2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBLAC1
Alternative Gene Name: MGC49416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049285: 85%, ENSRNOG00000001357: 85%
Entrez Gene ID: 255374
Uniprot ID: A4D2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE |
| Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574) | |
| Datasheet | Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link) |
| Vendor Page | Anti MBLAC1 pAb (ATL-HPA071574) at Atlas |
| Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574) | |
| Datasheet | Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link) |
| Vendor Page | Anti MBLAC1 pAb (ATL-HPA071574) |