Description
Product Description
Protein Description: metallo-beta-lactamase domain containing 1
Gene Name: MBLAC1
Alternative Gene Name: MGC49416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049285: 85%, ENSRNOG00000001357: 85%
Entrez Gene ID: 255374
Uniprot ID: A4D2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBLAC1
Alternative Gene Name: MGC49416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049285: 85%, ENSRNOG00000001357: 85%
Entrez Gene ID: 255374
Uniprot ID: A4D2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE |
Gene Sequence | HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE |
Gene ID - Mouse | ENSMUSG00000049285 |
Gene ID - Rat | ENSRNOG00000001357 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574) | |
Datasheet | Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link) |
Vendor Page | Anti MBLAC1 pAb (ATL-HPA071574) at Atlas Antibodies |
Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574) | |
Datasheet | Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link) |
Vendor Page | Anti MBLAC1 pAb (ATL-HPA071574) |