Anti MBD3L5 pAb (ATL-HPA060924)

Atlas Antibodies

Catalog No: ATL-HPA060924-25

• 

Product Description

Protein Description: methyl-CpG binding domain protein 3 like 5
Gene Name: MBD3L5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047508: 38%, ENSRNOG00000026629: 44%
Entrez Gene ID: 284428
Uniprot ID: A6NJ08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAK
• Gene Sequence: GRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAK
• Gene ID - Mouse: ENSMUSG00000047508
• Gene ID - Rat: ENSRNOG00000026629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.