Protein Description: methyl-CpG binding domain protein 1
Gene Name: MBD1
Alternative Gene Name: CXXC3, PCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024561: 68%, ENSRNOG00000024104: 66%
Entrez Gene ID: 4152
Uniprot ID: Q9UIS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MBD1
Alternative Gene Name: CXXC3, PCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024561: 68%, ENSRNOG00000024104: 66%
Entrez Gene ID: 4152
Uniprot ID: Q9UIS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK |
| Documents & Links for Anti MBD1 pAb (ATL-HPA068850) | |
| Datasheet | Anti MBD1 pAb (ATL-HPA068850) Datasheet (External Link) |
| Vendor Page | Anti MBD1 pAb (ATL-HPA068850) at Atlas |
| Documents & Links for Anti MBD1 pAb (ATL-HPA068850) | |
| Datasheet | Anti MBD1 pAb (ATL-HPA068850) Datasheet (External Link) |
| Vendor Page | Anti MBD1 pAb (ATL-HPA068850) |