Description
Product Description
Protein Description: megakaryocyte-associated tyrosine kinase
Gene Name: MATK
Alternative Gene Name: CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004933: 90%, ENSRNOG00000020431: 90%
Entrez Gene ID: 4145
Uniprot ID: P42679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MATK
Alternative Gene Name: CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004933: 90%, ENSRNOG00000020431: 90%
Entrez Gene ID: 4145
Uniprot ID: P42679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC |
Gene Sequence | YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC |
Gene ID - Mouse | ENSMUSG00000004933 |
Gene ID - Rat | ENSRNOG00000020431 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MATK pAb (ATL-HPA066547) | |
Datasheet | Anti MATK pAb (ATL-HPA066547) Datasheet (External Link) |
Vendor Page | Anti MATK pAb (ATL-HPA066547) at Atlas Antibodies |
Documents & Links for Anti MATK pAb (ATL-HPA066547) | |
Datasheet | Anti MATK pAb (ATL-HPA066547) Datasheet (External Link) |
Vendor Page | Anti MATK pAb (ATL-HPA066547) |