Protein Description: microtubule associated serine/threonine kinase 1
Gene Name: MAST1
Alternative Gene Name: KIAA0973, SAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053693: 98%, ENSRNOG00000003469: 98%
Entrez Gene ID: 22983
Uniprot ID: Q9Y2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAST1
Alternative Gene Name: KIAA0973, SAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053693: 98%, ENSRNOG00000003469: 98%
Entrez Gene ID: 22983
Uniprot ID: Q9Y2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE |
Documents & Links for Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) | |
Datasheet | Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) at Atlas |
Documents & Links for Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) | |
Datasheet | Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) |