Description
Product Description
Protein Description: MAP/microtubule affinity-regulating kinase 2
Gene Name: MARK2
Alternative Gene Name: EMK1, PAR-1, PAR-1B, Par1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024969: 93%, ENSRNOG00000021184: 70%
Entrez Gene ID: 2011
Uniprot ID: Q7KZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MARK2
Alternative Gene Name: EMK1, PAR-1, PAR-1B, Par1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024969: 93%, ENSRNOG00000021184: 70%
Entrez Gene ID: 2011
Uniprot ID: Q7KZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS |
Gene Sequence | EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS |
Gene ID - Mouse | ENSMUSG00000024969 |
Gene ID - Rat | ENSRNOG00000021184 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MARK2 pAb (ATL-HPA074905) | |
Datasheet | Anti MARK2 pAb (ATL-HPA074905) Datasheet (External Link) |
Vendor Page | Anti MARK2 pAb (ATL-HPA074905) at Atlas Antibodies |
Documents & Links for Anti MARK2 pAb (ATL-HPA074905) | |
Datasheet | Anti MARK2 pAb (ATL-HPA074905) Datasheet (External Link) |
Vendor Page | Anti MARK2 pAb (ATL-HPA074905) |