Protein Description: membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase
Gene Name: MARCH6
Alternative Gene Name: MARCH-VI, RNF176, TEB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039100: 90%, ENSRNOG00000011066: 90%
Entrez Gene ID: 10299
Uniprot ID: O60337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MARCH6
Alternative Gene Name: MARCH-VI, RNF176, TEB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039100: 90%, ENSRNOG00000011066: 90%
Entrez Gene ID: 10299
Uniprot ID: O60337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE |
| Documents & Links for Anti MARCH6 pAb (ATL-HPA063246) | |
| Datasheet | Anti MARCH6 pAb (ATL-HPA063246) Datasheet (External Link) |
| Vendor Page | Anti MARCH6 pAb (ATL-HPA063246) at Atlas |
| Documents & Links for Anti MARCH6 pAb (ATL-HPA063246) | |
| Datasheet | Anti MARCH6 pAb (ATL-HPA063246) Datasheet (External Link) |
| Vendor Page | Anti MARCH6 pAb (ATL-HPA063246) |