Description
Product Description
Protein Description: microtubule-associated protein tau
Gene Name: MAPT
Alternative Gene Name: DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018411: 55%, ENSRNOG00000005133: 57%
Entrez Gene ID: 4137
Uniprot ID: P10636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAPT
Alternative Gene Name: DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018411: 55%, ENSRNOG00000005133: 57%
Entrez Gene ID: 4137
Uniprot ID: P10636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS |
Gene Sequence | PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS |
Gene ID - Mouse | ENSMUSG00000018411 |
Gene ID - Rat | ENSRNOG00000005133 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MAPT pAb (ATL-HPA069524) | |
Datasheet | Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link) |
Vendor Page | Anti MAPT pAb (ATL-HPA069524) at Atlas Antibodies |
Documents & Links for Anti MAPT pAb (ATL-HPA069524) | |
Datasheet | Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link) |
Vendor Page | Anti MAPT pAb (ATL-HPA069524) |