Anti MAPT pAb (ATL-HPA069524)

Catalog No:
ATL-HPA069524-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Description

Product Description

Protein Description: microtubule-associated protein tau
Gene Name: MAPT
Alternative Gene Name: DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018411: 55%, ENSRNOG00000005133: 57%
Entrez Gene ID: 4137
Uniprot ID: P10636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Gene Sequence PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Gene ID - Mouse ENSMUSG00000018411
Gene ID - Rat ENSRNOG00000005133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPT pAb (ATL-HPA069524)
Datasheet Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link)
Vendor Page Anti MAPT pAb (ATL-HPA069524) at Atlas Antibodies

Documents & Links for Anti MAPT pAb (ATL-HPA069524)
Datasheet Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link)
Vendor Page Anti MAPT pAb (ATL-HPA069524)

Product Description

Protein Description: microtubule-associated protein tau
Gene Name: MAPT
Alternative Gene Name: DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018411: 55%, ENSRNOG00000005133: 57%
Entrez Gene ID: 4137
Uniprot ID: P10636
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Gene Sequence PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Gene ID - Mouse ENSMUSG00000018411
Gene ID - Rat ENSRNOG00000005133
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPT pAb (ATL-HPA069524)
Datasheet Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link)
Vendor Page Anti MAPT pAb (ATL-HPA069524) at Atlas Antibodies

Documents & Links for Anti MAPT pAb (ATL-HPA069524)
Datasheet Anti MAPT pAb (ATL-HPA069524) Datasheet (External Link)
Vendor Page Anti MAPT pAb (ATL-HPA069524)