Protein Description: mitogen-activated protein kinase-activated protein kinase 2
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 95%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 95%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL |
Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA064435) | |
Datasheet | Anti MAPKAPK2 pAb (ATL-HPA064435) Datasheet (External Link) |
Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA064435) at Atlas |
Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA064435) | |
Datasheet | Anti MAPKAPK2 pAb (ATL-HPA064435) Datasheet (External Link) |
Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA064435) |