Anti MAPKAPK2 pAb (ATL-HPA063708)

Catalog No:
ATL-HPA063708-25
$395.00

Description

Product Description

Protein Description: mitogen-activated protein kinase-activated protein kinase 2
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 92%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG
Gene Sequence QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG
Gene ID - Mouse ENSMUSG00000016528
Gene ID - Rat ENSRNOG00000004726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA063708)
Datasheet Anti MAPKAPK2 pAb (ATL-HPA063708) Datasheet (External Link)
Vendor Page Anti MAPKAPK2 pAb (ATL-HPA063708) at Atlas Antibodies

Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA063708)
Datasheet Anti MAPKAPK2 pAb (ATL-HPA063708) Datasheet (External Link)
Vendor Page Anti MAPKAPK2 pAb (ATL-HPA063708)

Product Description

Protein Description: mitogen-activated protein kinase-activated protein kinase 2
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 92%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG
Gene Sequence QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG
Gene ID - Mouse ENSMUSG00000016528
Gene ID - Rat ENSRNOG00000004726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA063708)
Datasheet Anti MAPKAPK2 pAb (ATL-HPA063708) Datasheet (External Link)
Vendor Page Anti MAPKAPK2 pAb (ATL-HPA063708) at Atlas Antibodies

Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA063708)
Datasheet Anti MAPKAPK2 pAb (ATL-HPA063708) Datasheet (External Link)
Vendor Page Anti MAPKAPK2 pAb (ATL-HPA063708)