Anti MAPK8IP3 pAb (ATL-HPA069311)

Catalog No:
ATL-HPA069311-25
$303.00

Description

Product Description

Protein Description: mitogen-activated protein kinase 8 interacting protein 3
Gene Name: MAPK8IP3
Alternative Gene Name: JIP3, JSAP1, KIAA1066, syd
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024163: 86%, ENSRNOG00000033568: 89%
Entrez Gene ID: 23162
Uniprot ID: Q9UPT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
Gene Sequence AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
Gene ID - Mouse ENSMUSG00000024163
Gene ID - Rat ENSRNOG00000033568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPK8IP3 pAb (ATL-HPA069311)
Datasheet Anti MAPK8IP3 pAb (ATL-HPA069311) Datasheet (External Link)
Vendor Page Anti MAPK8IP3 pAb (ATL-HPA069311) at Atlas Antibodies

Documents & Links for Anti MAPK8IP3 pAb (ATL-HPA069311)
Datasheet Anti MAPK8IP3 pAb (ATL-HPA069311) Datasheet (External Link)
Vendor Page Anti MAPK8IP3 pAb (ATL-HPA069311)

Product Description

Protein Description: mitogen-activated protein kinase 8 interacting protein 3
Gene Name: MAPK8IP3
Alternative Gene Name: JIP3, JSAP1, KIAA1066, syd
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024163: 86%, ENSRNOG00000033568: 89%
Entrez Gene ID: 23162
Uniprot ID: Q9UPT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
Gene Sequence AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
Gene ID - Mouse ENSMUSG00000024163
Gene ID - Rat ENSRNOG00000033568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MAPK8IP3 pAb (ATL-HPA069311)
Datasheet Anti MAPK8IP3 pAb (ATL-HPA069311) Datasheet (External Link)
Vendor Page Anti MAPK8IP3 pAb (ATL-HPA069311) at Atlas Antibodies

Documents & Links for Anti MAPK8IP3 pAb (ATL-HPA069311)
Datasheet Anti MAPK8IP3 pAb (ATL-HPA069311) Datasheet (External Link)
Vendor Page Anti MAPK8IP3 pAb (ATL-HPA069311)